PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g25370.2.p
Common NameBRADI_1g25370, LOC100829571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 460aa    MW: 52081.8 Da    PI: 7.619
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g25370.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.22.1e-129904582373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cAea+s++ +e+  +l+++ + ++s +g+p+qRl ay++e+L ar  +s+ ++y+al++++ +   s+e l+++k++++++P++kf+
  Bradi1g25370.2.p  90 KQLLTKCAEALSEDRTEEFLKLVQEARGIVSINGEPIQRLGAYLLEGLVARHGNSGRNIYRALRCRKPE---SKELLSYMKILYNICPYFKFG 179
                       689*****************************************************************9...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +++aN aI ea+ +e+ +HiiDf+i qG+QW++L+qaLa+Rp+gpp++RiTg+++p s+  + e le +g+ L+ + +e+++p+ef++l    
  Bradi1g25370.2.p 180 YMAANGAIAEALRSEDNIHIIDFQIAQGTQWITLIQALAARPGGPPHVRITGIDDPVSEyaRGEGLEIVGNMLKGMSKEFNIPLEFTPL-PVY 271
                       ********************************************************999999**************************6.777 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                        ++++ e+L+++pgEalaVn+ lqlh+++desv+++++rd +L++vk+lsPkv ++veqe+ +n+++F+ rf+e+++yysa+f+s++a+lpr+
  Bradi1g25370.2.p 272 ATQVTKEMLEIRPGEALAVNFTLQLHHTPDESVDVNNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFMMRFAETMDYYSAMFESIDANLPRD 364
                       88999**************************************************************************************** PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       ++eri+vE+++l+++ivn++aceg++r+erhe l+kW++rl++aGFkp+pls+++++ +k ll+ ++ d y++ee++g+++lgWk+r+L+s+S
  Bradi1g25370.2.p 365 NKERISVEQHCLAKDIVNIIACEGKDRVERHELLGKWKSRLTMAGFKPYPLSSYVNSVIKKLLACYS-DKYTLEEKDGAMLLGWKKRKLISAS 456
                       ****************************************************************999.55*********************** PP

              GRAS 372 aW 373
                       aW
  Bradi1g25370.2.p 457 AW 458
                       ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.01263440IPR005202Transcription factor GRAS
PfamPF035147.2E-12790458IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MQHALREIET VLMAPDADDA TTSAKHEFEE TKPAQLMRQR SRTWSHESRQ PLPGVVRPQF  60
ASGGYPMASY EFRPEKRQRE LRDDPQIIVK QLLTKCAEAL SEDRTEEFLK LVQEARGIVS  120
INGEPIQRLG AYLLEGLVAR HGNSGRNIYR ALRCRKPESK ELLSYMKILY NICPYFKFGY  180
MAANGAIAEA LRSEDNIHII DFQIAQGTQW ITLIQALAAR PGGPPHVRIT GIDDPVSEYA  240
RGEGLEIVGN MLKGMSKEFN IPLEFTPLPV YATQVTKEML EIRPGEALAV NFTLQLHHTP  300
DESVDVNNPR DGLLRMVKGL SPKVTTLVEQ ESHTNTTPFM MRFAETMDYY SAMFESIDAN  360
LPRDNKERIS VEQHCLAKDI VNIIACEGKD RVERHELLGK WKSRLTMAGF KPYPLSSYVN  420
SVIKKLLACY SDKYTLEEKD GAMLLGWKKR KLISASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-64894594375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3597010.0AK359701.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1101A23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562960.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLI1GTP00.0I1GTP0_BRADI; Uncharacterized protein
STRINGBRADI1G25370.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein